Rab29

This reagent and more can be found at our sister site MRC PPU Reagents & Services
Request Now
Synonyms
Rab7L1; Rab7L
Plasmid
pCMV5D Twin strep sumostar Rab29
Parent Plasmid
pCMV5D Twin strep sumo star
Expressed
Twin Strep SUMOstar Rab29
DU Number
DU62416
Tag
SUMO
StrepII
Species
Human
Sequence of Insert
GGATCCATGGGCAGCCGCGACCACCTGTTCAAAGTGCTGGTGGTGGGGGACGCCGCAGTGGGCAAGACGTCGCTGGTGCAGCGATATTCCCAGGACAGCTTCAGCAAACACTACAAGTCCACGGTGGGAGTGGATTTTGCTCTGAAGGTTCTCCAGTGGTCTGACTACGAGATAGTGCGGCTTCAGCTGTGGGATATTGCAGGGCAGGAGCGCTTCACCTCTATGACACGATTGTATTATCGGGATGCCTCTGCCTGTGTTATTATGTTTGACGTTACCAATGCCACTACCTTCAGCAACAGCCAGAGGTGGAAACAGGACCTAGACAGCAAGCTCACACTACCCAATGGAGAGCCGGTGCCCTGCCTGCTCTTGGCCAACAAGTGTGATCTGTCCCCTTGGGCAGTGAGCCGGGACCAGATTGACCGGTTCAGTAAAGAGAACGGTTTCACAGGTTGGACAGAAACATCAGTCAAGGAGAACAAAAATATTAATGAGGCTATGAGAGTCCTCATTGAAAAGATGATGAGAAATTCCACAGAAGATATCATGTCTTTGTCCACCCAAGGGGACTACATCAATCTACAAACCAAGTCCTCCAGCTGGTCCTGCTGCTAGCGGCCGC
Amino Acid Sequence
MWSHPQFEKGGGSGGGSGGSAWSHPQFEKMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLTFLFEGQEIADNHTPKELGMEEEDVIEVYQEQTGGSMGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC*
Vector Type
Mammalian
Antibiotic
Amp
Comments
Needs linker after SENP cleavage deleted to make clone flush
100042 R 1000 1001 1047 19007
Download datasheet