Rab8 Drosophila

Plasmid
pUAST att Rab8 Drosophila S111E
Parent Plasmid
pUAST att
Expressed
Rab8 Drosophila S111E
DU Number
DU26344
Species
Drosophila Melanogaster
Sequence of Insert
AGATCCATGGCCAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGCGATAGCGGCGTGGGCAAGACCTGCATCCTGTTCCGCTTCAGCGAGGATGCCTTCAACACCACCTTCATCAGCACCATCGGCATCGATTTCAAGATCCGCACCATCGAGCTGGACAACAAGAAGATCAAGCTGCAGATCTGGGATACCGCCGGACAGGAGCGCTTCCGCACGATTACCACCGCCTACTACCGCGGAGCCATGGGCATCATGCTGGTGTACGATATCACCCAGGAGAAGTCCTTCGAGAACATCAAGAACTGGATTCGCAACATCGAGGAGAACGCCGAGGCCGACGTGGAGAAGATGCTGCTGGGCAACAAGTGCGAGCTGACCGATAAGCGCCAGGTGTCCAAGGAGCGCGGAGAGCAGCTGGCCATCGAGTACGGCATCAAGTTCATGGAGACCAGCGCCAAGGCCAGCATCAACGTGGAGGAGGCCTTTCTGACCCTGGCCAGCGATATCAAGGCCAAGACCGAGAAGCGCATGGAGGCCAACAATCCCCCAAAGGGCGGCCACCAGCTGAAGCCGATGGATAGCCGCACCAAGGATAGCTGGCTGAGCCGCTGCAGCCTGCTGTAGGCGGCCGC

Amino Acid Sequence
MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENAEADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKDSWLSRCSLL*
Vector Type
Other
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now