Rab8 (drosophila)

Plasmid
pUAST Rab8 (drosophila)
Parent Plasmid
pUAST
Expressed
Rab8 (drosophila)
DU Number
DU51233
Genbank
NP_001246837.1
Species
Drosophila Melanogaster
Sequence of Insert
GGATCCATGGCCAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGCGATAGCGGCGTGGGCAAGACCTGCATCCTGTTCCGCTTCAGCGAGGATGCCTTCAACACCACCTTCATCAGCACCATCGGCATCGATTTCAAGATCCGCACCATCGAGCTGGACAACAAGAAGATCAAGCTGCAGATCTGGGATACCGCCGGACAGGAGCGCTTCCGCACGATTACCACCGCCTACTACCGCGGAGCCATGGGCATCATGCTGGTGTACGATATCACCCAGGAGAAGTCCTTCGAGAACATCAAGAACTGGATTCGCAACATCGAGGAGAACGCCAGCGCCGACGTGGAGAAGATGCTGCTGGGCAACAAGTGCGAGCTGACCGATAAGCGCCAGGTGTCCAAGGAGCGCGGAGAGCAGCTGGCCATCGAGTACGGCATCAAGTTCATGGAGACCAGCGCCAAGGCCAGCATCAACGTGGAGGAGGCCTTTCTGACCCTGGCCAGCGATATCAAGGCCAAGACCGAGAAGCGCATGGAGGCCAACAATCCCCCAAAGGGCGGCCACCAGCTGAAGCCGATGGATAGCCGCACCAAGGATAGCTGGCTGAGCCGCTGCAGCCTGCTGTAGGCGGCCGC
Amino Acid Sequence
MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIK
NWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKDSW
LSRCSLL*
Vector Type
Other
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now