RAB8A

Plasmid
pBABE puro HA Rab8a T72A
Parent Plasmid
pBABE puro HA
Expressed
HA RAB8A T72A
DU Number
DU51135
Genbank
p61006-1
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACG
CCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAAATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGC
CGGTCAGGAACGGTTTCGGGCGATCACAACGGCCTACTACAGGGGTGCAATGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAAC
ATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCTCTGCAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTT
CCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCT
CGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCCCCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGG
AGCAGCTTTTTCCGATGTGTTCTTCTGTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRAITTAYYRGAMGIMLVY
DITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQG
VKITPDQQKRSSFFRCVLL*
Vector Type
Mammalian
Antibiotic
Amp
Comments
in pBABE
100042 R 1000 1001 1047 19007
Enquire Now