Rab10

Plasmid
pFUSEss CLIg rK1 anti Rab10 pT73 (22-5) Light chain
Parent Plasmid
pFUSEss CLIg rK1
Expressed
anti-Rab10-pT73(22-5) rIgG LC
DU Number
DU68351
Genbank
N/A
Species
Human
Sequence of Insert
ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACGAATTCGCAGGTGCTGACCCAGACCCCCAGCAGCACCAGCGCCGCCGTGGGCGGCACCGTGACCATCAACTGCCAGAGCAGCGAGAGCGTGGACAGCAACAACAGGCTGAGCTGGTACCAGGAGAAGCCCGGCCAGCCCCCCAAGCTGCTGATCTACAGGGCCAGCACCCTGGCCAGCGGCGTGCCCAGCAGGTTCAGCGCCAGCGGCAGCGGCACCCAGTTCACCCTGACCATCAGCGACGTGCAGTGCGACGACGCCACCACCTACTACTGCGCCGCCAGGTACATCAGCAACATCGTGGTGTTCGGCGGCGGCACCGAGGTGGTGGTGAAGGATCCAGTTGCACCTACTGTCCTCATCTTCCCACCAGCTGCTGATCAGGTGGCAACTGGAACAGTCACCATCGTGTGTGTGGCGAATAAATACTTTCCCGATGTCACCGTCACCTGGGAGGTGGATGGCACCACCCAAACAACTGGCATCGAGAACAGTAAAACACCGCAGAACTCTGCAGATTGTACCTACAACCTCAGCAGCACTCTGACACTGACCAGCACACAGTACAACAGCCACAAAGAGTACACCTGCAAGGTGACCCAGGGCACGACCTCAGTCGTCCAGAGCTTCAACAGGGGTGACTGCTAG
Amino Acid Sequence
MYRMQLLSCIALSLALVTNSQVLTQTPSSTSAAVGGTVTINCQSSESVDSNNRLSWYQEKPGQPPKLLIYRASTLASGVPSRFSASGSGTQFTLTISDVQCDDATTYYCAARYISNIVVFGGGTEVVVKDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC*
Vector Type
Mammalian
Antibiotic
Blasticidin
100042 R 1000 1001 1047 19007
Enquire Now