This reagent and more can be found at our sister site MRC PPU Reagents & Services 
      Request Now
    
Full Name
              RAB8A (172 - 203)
          Long Name Textual
              RAB8A, member RAS oncogene family
          Immuno Sequence
              CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human]
          Mono/Poly clonal
              Polyclonal
          Sheep No
              S969D
          Aliquot
              0.1mg
          100041 R 1000 1001 1047 19007
      
  Gel Image
          
Gel Description
          Figure One - Lysates of A549 WT cells and A549 Rab8A KO cells, 20 µg of protein was loaded per lane.  The antibodies were used in 5% milk in TBST at 1 ug/ml. The membranes were incubated with the antibodies overnight in 4°C. The secondary sheep antibody conjugated with HRP was used in 5% milk in TBST for 1 hour at RT.                                Figure Two - For IP with S969D 200 µg of Ab was coupled with 1000 µl of crude beads and then 30 µl of beads used per 1 mg of protein. IP was performed for 3 h at 4°C. Lysates of A549 WT and A549 Rab8A KO were used.
               
         
          