Rab8b

Plasmid
pcDNA5 FRT/TO HA Rab8b S111A S182A
Parent Plasmid
pcDNA5 FRT/TO HA
Expressed
HA Rab8b S111A S182A
DU Number
DU67035
Genbank
Q92930
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACGTACGATTATCTCTTCAAGCTCCTGCTGATCGGCGACTCGGGGGTAGGCAAGACCTGCCTCCTGTTCCGCTTCTCAGAGGACGCCTTCAACACCACCTTCATCTCCACCATCGGAATTGATTTTAAAATTAGAACGATAGAACTAGATGGAAAGAAAATTAAGCTTCAGATATGGGACACAGCGGGTCAGGAAAGATTCCGAACAATCACGACAGCGTACTACAGAGGAGCCATGGGCATTATGCTGGTCTATGACATCACAAATGAAAAATCCTTTGACAATATTAAAAATTGGATCAGAAACATTGAAGAGCATGCCGCTTCCGATGTCGAAAGAATGATCCTGGGTAACAAATGTGATATGAATGACAAAAGACAAGTGTCAAAAGAAAGAGGGGAGAAGCTAGCAATTGACTATGGGATTAAATTCTTGGAGACAAGCGCAAAATCCAGTGCAAATGTAGAAGAGGCATTTTTTACACTTGCACGAGATATAATGACAAAACTCAACAGAAAAATGAATGACAGCAATGCCGCAGGAGCAGGTGGACCAGTGAAAATAACAGAAAACCGATCAAAGAAGACCAGTTTCTTTCGTTGCTCGCTACTTTGAGCGGCCGC

Amino Acid Sequence
MYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVY
DITNEKSFDNIKNWIRNIEEHAASDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNAAGAGGP
VKITENRSKKTSFFRCSLL*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now