VPS26A

Plasmid
pLVX Hygro GFP VPS26A K297 TAG (amber stop)
Parent Plasmid
pLVX Hygro GFP
Expressed
GFP VPS26A K297 TAG (amber stop)
DU Number
DU62348
Genbank
NM_001318945
Tag
GFP
Species
Human
Sequence of Insert
CTCGAGATGAGTTTTCTTGGAGGCTTTTTTGGTCCAATTTGTGAGATCGATATTGTTCTTAATGATGGGGAAACCAGGAAAATGGCAGAAATGAAAACTGAAGATGGCAAAGTAGAAAAACACTATCTCTTCTATGACGGAGAATCCGTTTCAGGAAAGGTAAACCTAGCCTTTAAGCAACCTGGAAAGAGGCTAGAACACCAAGGAATTAGAATTGAATTTGTAGGTCAAATTGAACTTTTCAATGACAAGAGTAATACTCATGAATTTGTAAACCTAGTGAAAGAACTAGCCTTACCTGGAGAACTGACTCAGAGCAGAAGTTATGATTTTGAATTTATGCAAGTTGAAAAGCCATATGAATCTTACATCGGTGCCAATGTCCGCTTGAGGTATTTTCTTAAAGTGACAATAGTGAGAAGACTGACAGATTTGGTAAAAGAGTATGATCTTATTGTTCACCAGCTTGCCACCTATCCTGATGTTAACAACTCTATTAAGATGGAAGTGGGCATTGAAGATTGTCTACATATAGAATTTGAATATAATAAATCAAAGTATCATTTAAAGGATGTGATTGTTGGAAAAATTTACTTCTTATTAGTAAGAATAAAAATACAACATATGGAGTTACAGCTGATCAAAAAAGAGATCACAGGAATTGGACCCAGTACCACAACAGAAACAGAAACAATCGCCAAATATGAAATAATGGATGGTGCACCAGTAAAAGGTGAATCAATTCCAATAAGGCTATTTTTAGCAGGATATGACCCAACTCCAACAATGAGAGATGTGAACAAAAAATTTTCAGTAAGGTACTTTTTGAATTTAGTGCTTGTTGATGAGGAAGACCGGAGGTACTTCAAACAGCAGGAGATAATTTTATGGAGATAGGCTCCTGAAAAACTGAGGAAACAGAGAACAAACTTTCACCAGCGATTTGAATCTCCAGAATCACAGGCATCTGCCGAACAGCCTGAAATGTGAGGATCC
Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKLEMSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRZAPEKLRKQRTNFHQRFESPESQASAEQPEM*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now