Rab8a (mouse)

Plasmid
pSC-B Rab8a Mouse
Parent Plasmid
pSC-B
DU Number
DU27697
Genbank
P55258-1
Species
Mouse
Sequence of Insert
GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTAGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACGCCTTCAACTCCACATTCATCTCTACCATAGGAATTGACTTTAAAATTAGGACCATAGAGCTCGATGGCAAGAGGATTAAACTGCAGATATGGGACACGGCCGGCCAGGAGCGGTTTCGAACAATCACGACAGCCTACTACAGGGGTGCCATGGGTATCATGCTGGTCTACGACATTACCAATGAGAAGTCCTTTGACAACATCCGGAATTGGATTCGGAACATTGAAGAGCATGCCTCTGCAGACGTGGAGAAGATGATACTGGGGAATAAGTGTGATGTGAATGACAAGAGACAGGTGTCCAAGGAACGGGGAGAAAAGCTGGCACTCGACTATGGGATCAAGTTCATGGAGACCAGTGCAAAGGCCAACATCAATGTGGAGAATGCATTTTTCACTCTTGCCAGGGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGGAACAGCCCGCAGGGGAGCAGCCATGGAGTCAAGATCACAGTGGAGCAGCAGAAGAGGACCAGCTTCTTCCGGTGCAGTCTCCTGTGAGCGGCCGC
Amino Acid Sequence
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL*
Vector Type
Other
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now