Rab8a (mouse)

Plasmid
pCMV5D HA Rab8a Mouse
Parent Plasmid
pCMV5D HA
Expressed
HA Rab8a Mouse
DU Number
DU27730
Genbank
P55258-1
Tag
HA
Species
Mouse
Sequence of Insert
GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTAGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACGCCTTCAACTCCACATTCATCTCTACCATAGGAATTGACTTTAAAATTAGGACCATAGAGCTCGATGGCAAGAGGATTAAACTGCAGATATGGGACACGGCCGGCCAGGAGCGGTTTCGAACAATCACGACAGCCTACTACAGGGGTGCCATGGGTATCATGCTGGTCTACGACATTACCAATGAGAAGTCCTTTGACAACATCCGGAATTGGATTCGGAACATTGAAGAGCATGCCTCTGCAGACGTGGAGAAGATGATACTGGGGAATAAGTGTGATGTGAATGACAAGAGACAGGTGTCCAAGGAACGGGGAGAAAAGCTGGCACTCGACTATGGGATCAAGTTCATGGAGACCAGTGCAAAGGCCAACATCAATGTGGAGAATGCATTTTTCACTCTTGCCAGGGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGGAACAGCCCGCAGGGGAGCAGCCATGGAGTCAAGATCACAGTGGAGCAGCAGAAGAGGACCAGCTTCTTCCGGTGCAGTCTCCTGTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now