Rab43

Plasmid
pBabe hygro Rab 43
Parent Plasmid
pBABE hygro
Expressed
Rab43
DU Number
DU27350
Genbank
NM_198490.2 GI:325910889
Species
Human
Sequence of Insert
GGATCCATGGCAGGGCCGGGCCCAGGCCCGGGGGACCCGGACGAGCAGTACGATTTCCTGTTCAAGCTGGTGCTGGTGGGCGACGCAAGCGTGGGCAAGACGTGCGTGGTGCAGCGCTTCAAGACCGGCGCCTTCTCGGAGCGCCAGGGAAGCACCATCGGCGTCGACTTCACCATGAAGACGCTGGAGATCCAGGGCAAGCGGGTCAAGCTGCAGATCTGGGACACGGCCGGCCAGGAGCGGTTCCGCACCATCACCCAGAGCTACTACCGCAGTGCCAATGGGGCCATCCTTGCCTACGACATCACCAAGAGGAGCTCCTTCCTGTCGGTGCCTCACTGGATTGAGGATGTGAGGAAGTATGCGGGCTCCAACATTGTGCAGCTGCTGATCGGGAACAAGTCAGACCTCAGCGAGCTTCGGGAGGTCTCCTTGGCTGAGGCACAGAGCCTGGCTGAGCACTATGACATCCTGTGTGCCATTGAGACGTCTGCCAAGGACTCGAGCAACGTGGAGGAGGCCTTCCTGAGGGTGGCCACGGAGCTCATCATGCGGCACGGGGGCCCCTTGTTCAGCGAGAAGAGCCCCGACCACATCCAGCTGAACAGCAAGGACATCGGAGAAGGCTGGGGCTGCGGGTGCTGAGCGGCCGC
Amino Acid Sequence
MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now