Rab8A

Plasmid
pNHD1.3 6HIS Rab8a S111TAG + Gro EL/ES
Parent Plasmid
pNHD1.3 + Gro EL/ES
Expressed
6His Rab8A S111TAG+ GRO EL/ES
DU Number
DU56041
Genbank
P61006
Tag
6His
Species
Human
Amino Acid Sequence
MGHHHHHHMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITN
EKSFDNIRNWIRNIEEHA*ADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKIT
PDQQKRSSFFRCVLL*
Vector Type
Bacterial
Antibiotic
Tetracycline
100042 R 1000 1001 1047 19007
Enquire Now