Rab3d

Plasmid
pCMV5D HA RAB3D T86A
Parent Plasmid
pCMV5D HA
Expressed
HA Rab3d T86A
DU Number
DU26876
Genbank
NM_004283.3
Tag
HA
Sequence of Insert
GGATCCATGGCATCAGCTGGAGACACCCAGGCAGGCCCACGGGATGCAGCAGATCAGAACTTCGACTATATGTTCAAACTGCTACTGATAGGCAACAGCAGTGTGGGCAAGACTTCCTTCCTGTTCCGATACGCGGACGACTCCTTCACTCCCGCCTTCGTCAGTACTGTGGGCATCGATTTCAAGGTCAAGACCGTCTACCGCCATGACAAGAGGATCAAGCTGCAGATCTGGGACACAGCGGGCCAGGAGCGCTACCGCGCCATCACCACGGCCTACTACCGGGGAGCCATGGGCTTCCTGCTCATGTATGACATCGCCAATCAGGAATCCTTTGCCGCTGTGCAGGACTGGGCCACGCAAATCAAGACCTACTCCTGGGACAACGCCCAGGTCATCCTGGTGGGGAACAAGTGTGACCTGGAGGACGAACGTGTTGTGCCTGCTGAGGATGGCCGGAGGCTCGCCGACGACCTTGGTTTCGAGTTCTTTGAAGCCAGTGCCAAGGAGAACATCAATGTGAAGCAGGTCTTCGAGCGCCTGGTGGATGTCATCTGCGAGAAGATGAACGAGTCCCTGGAACCCAGCTCCAGCTCAGGCAGCAACGGGAAAGGCCCGGCCGTGGGGGATGCTCCAGCCCCCCAGCCCAGCAGCTGCAGCTGCTAGGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRAITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now