RAB3C

Plasmid
pCMV5D HA Rab3C T86A
Parent Plasmid
pCMV5D HA
Expressed
HA Rab3c T86A
DU Number
DU26868
Genbank
NM_138453
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGAGACACGAAGCGCCCATGCAGATGGCCTCTGCCCAAGATGCCAGGTACGGCCAGAAAGACTCCTCTGATCAGAACTTTGACTACATGTTCAAATTACTCATCATCGGCAATAGCAGTGTGGGGAAAACATCTTTTCTATTCCGTTATGCAGATGACTCCTTTACATCTGCATTCGTCAGCACAGTTGGGATCGATTTCAAAGTAAAAACTGTATTCAAAAATGAAAAGAGAATCAAGCTTCAGATTTGGGACGCAGCAGGCCAGGAAAGATACAGGACTATCACCACAGCCTATTATCGTGGAGCCATGGGCTTTATTTTAATGTATGACATTACAAATGAAGAATCCTTCAATGCAGTACAAGATTGGTCAACTCAAATCAAAACATACTCTTGGGACAATGCCCAAGTTATTCTGGTTGGGAACAAGTGTGACATGGAAGACGAGCGGGTCATCTCAACTGAGCGAGGTCAACATTTAGGAGAACAGCTTGGGTTTGAGTTTTTTGAAACAAGTGCCAAGGACAACATTAATGTCAAGCAGACATTTGAGCGCCTTGTGGATATCATCTGCGACAAAATGTCAGAGAGTTTGGAGACTGATCCTGCCATCACTGCTGCAAAGCAGAACACGAGACTCAAGGAAACTCCTCCTCCACCGCAGCCCAACTGTGCCTGCTAGGCGGCCGCT
Amino Acid Sequence
MYPYDVPDYAGSMRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDAAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now