Rab3b

Plasmid
pCMV5D HA RAB3B T86A
Parent Plasmid
pCMV5D HA
Expressed
HA Rab3b T86A
DU Number
DU26871
Genbank
NM_002867
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGCTTCAGTGACAGATGGTAAAACTGGAGTCAAAGATGCCTCTGACCAGAATTTTGACTACATGTTTAAACTGCTTATCATTGGCAACAGCAGTGTTGGCAAGACCTCCTTCCTCTTCCGCTATGCTGATGACACGTTCACCCCAGCCTTCGTTAGCACCGTGGGCATCGACTTCAAGGTGAAGACAGTCTACCGTCACGAGAAGCGGGTGAAACTGCAGATCTGGGACACAGCTGGGCAGGAGCGGTACCGGGCCATCACAACAGCCTATTACCGTGGGGCCATGGGCTTCATTCTGATGTATGACATCACCAATGAAGAGTCCTTCAATGCTGTCCAAGACTGGGCTACTCAGATCAAGACCTACTCCTGGGACAATGCACAAGTTATTCTGGTGGGGAACAAGTGTGACATGGAGGAAGAGAGGGTTGTTCCCACTGAGAAGGGCCAGCTCCTTGCAGAGCAGCTTGGGTTTGATTTCTTTGAAGCCAGTGCAAAGGAGAACATCAGTGTAAGGCAGGCCTTTGAGCGCCTGGTGGATGCCATTTGTGACAAGATGTCTGATTCGCTGGACACAGACCCGTCGATGCTGGGCTCCTCCAAGAACACGCGTCTCTCGGACACCCCACCGCTGCTGCAGCAGAACTGCTCATGCTAGGCGGCCGCT
Amino Acid Sequence
MYPYDVPDYAGSMASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRAITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now