RAB8a

Plasmid
pcDNA5 FRT/TO Pink1 3FLAG IRES HA RAB8a
Parent Plasmid
pcDNA5 FRT/TO
Expressed
PINK1 3FLAG & HA-Rab8A
DU Number
DU51738
Tag
HA
Species
Human
Amino Acid Sequence
MYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVY
DITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQG
VKITPDQQKRSSFFRCVLL*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now