Rab1B S22N

Plasmid
pCDNA5 FRT/TO GFP Rab1B S22N
Parent Plasmid
pcDNA5 FRT/TO GFP
Expressed
GFP Rab1B S22N
DU Number
DU51752
Genbank
Q9H0U4
Tag
GFP
Species
Human
Sequence of Insert
GGATCCATGAACCCCGAATATGACTACCTGTTTAAGCTGCTTTTGATTGG
CGACTCAGGCGTGGGCAAGAATTGCCTGCTCCTGCGGTTTGCTGATGACA
CGTACACAGAGAGCTACATCAGCACCATCGGGGTGGACTTCAAGATCCGA
ACCATCGAGCTGGATGGCAAAACTATCAAACTTCAGATCTGGGACACAGC
GGGCCAGGAACGGTTCCGGACCATCACTTCCAGCTACTACCGGGGGGCTC
ATGGCATCATCGTGGTGTATGACGTCACTGACCAGGAATCCTACGCCAAC
GTGAAGCAGTGGCTGCAGGAGATTGACCGCTATGCCAGCGAGAACGTCAA
TAAGCTCCTGGTGGGCAACAAGAGCGACCTCACCACCAAGAAGGTGGTGG
ACAACACCACAGCCAAGGAGTTTGCAGACTCTCTGGGCATCCCCTTCTTG
GAGACGAGCGCCAAGAATGCCACCAATGTCGAGCAGGCGTTCATGACCAT
GGCTGCTGAAATCAAAAAGCGGATGGGGCCTGGAGCAGCCTCTGGGGGCG
AGCGGCCCAATCTCAAGATCGACAGCACCCCTGTAAAGCCGGCTGGCGGT
GGCTGTTGCTAGGCGGCCGC
Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT
TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN
VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMNPEYD
YLFKLLLIGDSGVGKNCLLLRFADDTYTESYISTIGVDFKIRTIELDGKT
IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEI
DRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNAT
NVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now