Rab3C

Plasmid
pCMV5 HA Rab3C
Parent Plasmid
pCMV5 HA
Expressed
HA Rab3C
DU Number
DU55048
Genbank
NM_138453
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGAGACACGAAGCGCCCATGCAGATGGCCTCTGCCCAAGATGCCAGGTACGGCCAGAAAGACTCCTCTGATCAGAACTTTGACTACATGTTCAAATTACTCATCATCGGCAATAGCAGTGTGGGGAAAACATCTTTTCTATTCCGTTATGCAGATGACTCCTTTACATCTGCATTCGTCAGCACAGTTGGGATCGATTTCAAAGTAAAAACTGTATTCAAAAATGAAAAGAGAATCAAGCTTCAGATTTGGGACACAGCAGGCCAGGAAAGATACAGGACTATCACCACAGCCTATTATCGTGGAGCCATGGGCTTTATTTTAATGTATGACATTACAAATGAAGAATCCTTCAATGCAGTACAAGATTGGTCAACTCAAATCAAAACATACTCTTGGGACAATGCCCAAGTTATTCTGGTTGGGAACAAGTGTGACATGGAAGACGAGCGGGTCATCTCAACTGAGCGAGGTCAACATTTAGGAGAACAGCTTGGGTTTGAGTTTTTTGAAACAAGTGCCAAGGACAACATTAATGTCAAGCAGACATTTGAGCGCCTTGTGGATATCATCTGCGACAAAATGTCAGAGAGTTTGGAGACTGATCCTGCCATCACTGCTGCAAAGCAGAACACGAGACTCAAGGAAACTCCTCCTCCACCGCAGCCCAACTGTGCCTGCTAGGCGGCCGC



Amino Acid Sequence
MYPYDVPDYAGSMRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now