RAB33B

Synonyms
SMC2
Plasmid
pCMV5 HA DU Rab33b
Parent Plasmid
pCMV5 HA DU
Expressed
HA-Rab33b
DU Number
DU28314
Genbank
NM_031296.1
Tag
HA
Species
Human
Sequence of Insert
ggatccATGGCTGAGGAGATGGAGTCGTCGCTCGAGGCAAGCTTTTCGTCCAGCGGGGCAGTGTCAGGGGCCTCAGGGTTTTTGCCTCCTGCCCGCTCCCGCATCTTCAAGATAATCGTGATCGGCGACTCCAATGTGGGCAAGACATGCCTGACCTACCGCTTCTGCGCTGGCCGCTTCCCCGACCGCACCGAGGCCACGATAGGGGTGGATTTCCGAGAACGAGCGGTGGAGATTGATGGGGAGCGCATCAAGATCCAGCTATGGGACACAGCAGGACAAGAACGATTCAGAAAGAGCATGGTTCAGCACTACTACAGAAATGTACATGCTGTTGTCTTCGTGTATGATATGACCAACATGGCTAGTTTTCATAGCCTACCATCTTGGATAGAAGAATGCAAACAACATTTGCTAGCCAATGATATACCACGGATTCTTGTTGGAAATAAATGTGACTTGAGAAGTGCCATACAGGTACCCACAGACTTGGCACAAAAATTTGCTGACACACACAGTATGCCTTTGTTTGAAACGTCTGCTAAAAACCCCAATGATAATGACCATGTGGAAGCTATATTTATGACCTTGGCTCATAAGCTTAAGAGCCACAAACCATTAATGCTTAGTCAGCCCCCTGATAATGGAATTATCCTGAAGCCTGAACCAAAGCCTGCAATGACGTGCTGGTGCTAAgcggccgc
Amino Acid Sequence
MYPYDVPDYAGSMAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV
IGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVEIDGERIKIQLWD
TAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLA
NDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHV
EAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAMTCWC*
Vector Type
Other
Antibiotic
Amp
Comments
Parental 44059
100042 R 1000 1001 1047 19007
Enquire Now