Rab33A

Synonyms
RabS10
Plasmid
pCMV5 HA DU Rab33a
Parent Plasmid
pCMV5 HA DU
Expressed
HA-Rab33a
DU Number
DU28313
Genbank
NM_004794.2 → NP_004785.1
Tag
HA
Species
Human
Sequence of Insert
AGATCTATGGCGCAGCCCATCCTGGGCCATGGGAGCCTGCAGCCCGCCTCGGCCGCTGGCCTGGCGTCCCTGGAGCTCGACTCGTCGCTGGACCAGTACGTGCAGATTCGCATCTTCAAAATAATCGTGATTGGGGACTCCAACGTGGGCAAGACCTGCCTGACCTTCCGCTTCTGCGGGGGTACCTTCCCAGACAAGACTGAAGCCACCATCGGCGTGGACTTCAGGGAGAAGACCGTGGAAATCGAGGGCGAGAAGATCAAGGTTCAGGTGTGGGACACAGCAGGTCAGGAACGTTTCCGCAAAAGCATGGTCGAGCATTACTACCGCAACGTACATGCCGTGGTCTTCGTCTATGACGTCACCAAGATGACATCTTTCACCAACCTCAAAATGTGGATCCAAGAATGCAATGGGCATGCTGTGCCCCCACTAGTCCCCAAAGTGCTTGTGGGCAACAAGTGTGACTTGAGGGAACAGATCCAGGTGCCCTCCAACTTAGCCCTGAAATTTGCTGATGCCCACAACATGCTCTTGTTTGAGACATCGGCCAAGGACCCCAAAGAGAGCCAGAACGTGGAGTCGATTTTCATGTGCTTGGCTTGCCGATTGAAGGCCCAGAAATCCCTGCTGTATCGTGATGCTGAGAGGCAGCAGGGGAAGGTGCAGAAACTGGAGTTCCCACAGGAAGCTAACAGTAAAACTTCCTGTCCTTGTTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFK
IIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQ
VWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGH
AVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKES
QNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC*
Vector Type
Mammalian
Antibiotic
Amp
Comments
Parental 44059
100042 R 1000 1001 1047 19007
Enquire Now