Rab31

Synonyms
ras-related protein Rab-31, Rab22b
Plasmid
pET 6HIS SUMO-Rab31
Parent Plasmid
pET 6HIS SUMO
DU Number
DU28275
Genbank
NM_006868.3 → NP_006859.2 Gene ID 11031 Uniprot Q13636
Tag
6His
SUMO
Species
Human
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTH
LKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGMMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTK
TVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYT
LKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVV
ETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC*
Vector Type
Bacterial
Antibiotic
Amp
Comments
Parental 32993.
100042 R 1000 1001 1047 19007
Enquire Now