Rab39b

Synonyms
WSMN; MRX72
Plasmid
pcDNA5D FRT/TO HA Rab39b G192R
Parent Plasmid
pcDNA5D FRT/TO HA
Expressed
HA Rab39b G192R
DU Number
DU26442
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGAGGCCATCTGGCTGTACCAGTTCCGGCTCATTGTCATCGGGGATTCCACAGTGGGCAAGTCCTGCCTGATCCGCCGCTTCACCGAGGGTCGCTTTGCCCAGGTTTCTGACCCCACCGTGGGGGTGGATTTTTTCTCCCGCTTGGTGGAGATCGAGCCAGGAAAACGCATCAAGCTCCAGATCTGGGATACCGCGGGTCAAGAGAGGTTCAGATCCATCACTCGCGCCTACTACAGGAACTCAGTAGGTGGTCTTCTCTTATTTGACATTACCAACCGCAGGTCCTTCCAGAATGTCCATGAGTGGTTAGAAGAGACCAAAGTACACGTTCAGCCCTACCAAATTGTATTTGTTCTGGTGGGTCACAAGTGTGACCTGGATACACAGAGGCAAGTGACTCGCCACGAGGCCGAGAAACTGGCTGCTGCATACGGCATGAAGTACATTGAAACGTCAGCCCGAGATGCCATTAATGTGGAGAAAGCCTTCACAGACCTGACAAGAGACATATATGAGCTGGTTAAAAGGGGGGAGATTACAATCCAGGAGGGCTGGGAAGGGGTGAAGAGTAGATTTGTACCAAATGTGGTTCACTCTTCAGAAGAGGTTGTCAAATCAGAGAGGAGATGTTTGTGCTAGGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSRFVPNVVHSSEEVVKSERRCLC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now