Rab31

Synonyms
ras-related protein Rab-31, Rab22b
Plasmid
pCMV-HA-Rab31
Parent Plasmid
pCMV HA
Expressed
HA-Rab31
DU Number
DU28252
Genbank
NM_006868.3 → NP_006859.2 Gene ID 11031 Uniprot Q13636
Tag
HA
Species
Human
Sequence of Insert
ggatccATGATGGCGATACGGGAGCTCAAAGTGTGCCTTCTCGGGGACACTGGGGTTGGGAAATCAAGCATCGTGTGTCGATTTGTCCAGGATCACTTTGACCACAACATCAGCCCTACTATTGGGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTGAgcggccgc
Amino Acid Sequence
MYPYDVPDYAGSMMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDI
TKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTM
QASRRCC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now