Rab39a

Plasmid
pCMV5D GFP Rab39a
Parent Plasmid
pCMV5D GFP
Expressed
GFP Rab39a
DU Number
DU51554
Tag
GFP
Species
Human
Sequence of Insert
GGATCCATGGAGACCATCTGGATCTACCAGTTCCGCCTCATCGTGATCGGGGACTCCACCGTGGGCAAGTCCTGCCTCCTGCACCGCTTCACCCAGGGCC
GCTTCCCCGGGCTGCGCTCCCCCGCCTGCGACCCCACCGTCGGCGTGGACTTCTTCTCCCGCCTGCTGGAGATCGAGCCGGGCAAGAGGATCAAGCTACA
GCTCTGGGACACGGCGGGACAGGAGCGGTTCAGATCAATAACCCGATCTTATTACCGCAACTCAGTTGGTGGATTTTTAGTATTTGACATTACTAACCGA
CGATCTTTTGAACATGTGAAAGATTGGCTAGAAGAAGCAAAAATGTATGTACAGCCATTTCGGATTGTATTTCTGCTAGTGGGACATAAATGTGATTTAG
CTTCACAACGTCAAGTTACAAGGGAAGAAGCTGAAAAACTGTCAGCAGACTGTGGAATGAAGTATATAGAAACCTCAGCAAAGGATGCTACAAATGTTGA
AGAATCCTTCACAATCTTGACGAGAGACATATATGAACTTATTAAAAAGGGAGAAATTTGTATTCAGGATGGCTGGGAAGGGGTTAAAAGTGGTTTTGTT
CCAAATACTGTGCATTCTTCTGAGGAAGCAGTAAAGCCCAGGAAAGAATGCTTCTGCTGAGCGGCCGC
Amino Acid Sequence
MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI
FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN
HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGSMETIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEP
GKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSA
KDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now