RAB30

Plasmid
pcDNA5 FRT/TO GFP RAB30
Parent Plasmid
pcDNA5 FRT/TO GFP
Expressed
GFP RAB30
DU Number
DU51547
Species
Human
Sequence of Insert
GGATCCATGAGTATGGAAGATTATGATTTCCTGTTCAAAATTGTTTTAATTGGCAACGCTGGTGTGGGGAAGACGTGCCTCGTCCGAAGATTCACTCAGG
GTCTTTTCCCCCCAGGTCAAGGAGCCACAATTGGAGTTGATTTTATGATTAAGACAGTGGAGATTAATGGTGAAAAAGTAAAGCTACAGATCTGGGACAC
AGCAGGTCAAGAGAGATTTCGGTCCATTACCCAGAGTTACTACCGAAGCGCCAATGCCTTGATCCTCACCTATGACATTACCTGTGAGGAATCCTTCCGT
TGCCTTCCTGAGTGGCTGCGGGAGATAGAACAATATGCCAGCAACAAGGTCATCACTGTGTTAGTGGGCAACAAGATTGACCTGGCTGAAAGGAGAGAGG
TTTCCCAGCAGCGAGCTGAAGAATTCTCAGAAGCTCAGGACATGTATTATCTGGAGACCTCAGCCAAGGAATCTGATAATGTGGAGAAACTCTTCCTTGA
CTTAGCATGCCGACTCATCAGTGAAGCCAGACAGAACACACTTGTGAACAATGTATCCTCACCCTTACCTGGAGAAGGGAAAAGCATCAGCTATTTGACT
TGTTGTAATTTCAACTAAGCGGCCGC
Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGE
KVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKES
DNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN*
Vector Type
Other
Antibiotic
Amp; Kan
100042 R 1000 1001 1047 19007
Enquire Now