Rab39a

Plasmid
pcDNA5 FRT/TO GFP Rab39A
Parent Plasmid
pcDNA5 FRT/TO GFP
Expressed
GFP Rab39A
DU Number
DU51544
Genbank
NM_017516.2
Tag
GFP
Species
Human
Sequence of Insert
GGATCCATGGAGACCATCTGGATCTACCAGTTCCGCCTCATCGTGATCGGGGACTCCACCGTGGGCAAGTCCTGCCTCCTGCACCGCTTCACCCAGGGCC
GCTTCCCCGGGCTGCGCTCCCCCGCCTGCGACCCCACCGTCGGCGTGGACTTCTTCTCCCGCCTGCTGGAGATCGAGCCGGGCAAGAGGATCAAGCTACA
GCTCTGGGACACGGCGGGACAGGAGCGGTTCAGATCAATAACCCGATCTTATTACCGCAACTCAGTTGGTGGATTTTTAGTATTTGACATTACTAACCGA
CGATCTTTTGAACATGTGAAAGATTGGCTAGAAGAAGCAAAAATGTATGTACAGCCATTTCGGATTGTATTTCTGCTAGTGGGACATAAATGTGATTTAG
CTTCACAACGTCAAGTTACAAGGGAAGAAGCTGAAAAACTGTCAGCAGACTGTGGAATGAAGTATATAGAAACCTCAGCAAAGGATGCTACAAATGTTGA
AGAATCCTTCACAATCTTGACGAGAGACATATATGAACTTATTAAAAAGGGAGAAATTTGTATTCAGGATGGCTGGGAAGGGGTTAAAAGTGGTTTTGTT
CCAAATACTGTGCATTCTTCTGAGGAAGCAGTAAAGCCCAGGAAAGAATGCTTCTGCTGAGCGGCCGC
Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMETIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEI
EPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIET
SAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now