RAB30

Plasmid
pCMV5D GFP RAB30
Parent Plasmid
pCMV5D GFP
Expressed
GFP RAB30
DU Number
DU51543
Tag
GFP
Species
Human
Sequence of Insert
GGATCCATGAGTATGGAAGATTATGATTTCCTGTTCAAAATTGTTTTAATTGGCAACGCTGGTGTGGGGAAGACGTGCCTCGTCCGAAGATTCACTCAGG
GTCTTTTCCCCCCAGGTCAAGGAGCCACAATTGGAGTTGATTTTATGATTAAGACAGTGGAGATTAATGGTGAAAAAGTAAAGCTACAGATCTGGGACAC
AGCAGGTCAAGAGAGATTTCGGTCCATTACCCAGAGTTACTACCGAAGCGCCAATGCCTTGATCCTCACCTATGACATTACCTGTGAGGAATCCTTCCGT
TGCCTTCCTGAGTGGCTGCGGGAGATAGAACAATATGCCAGCAACAAGGTCATCACTGTGTTAGTGGGCAACAAGATTGACCTGGCTGAAAGGAGAGAGG
TTTCCCAGCAGCGAGCTGAAGAATTCTCAGAAGCTCAGGACATGTATTATCTGGAGACCTCAGCCAAGGAATCTGATAATGTGGAGAAACTCTTCCTTGA
CTTAGCATGCCGACTCATCAGTGAAGCCAGACAGAACACACTTGTGAACAATGTATCCTCACCCTTACCTGGAGAAGGGAAAAGCATCAGCTATTTGACT
TGTTGTAATTTCAACTAAGCGGCCGC
Amino Acid Sequence
MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI
FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN
HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGSMSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKV
KLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDN
VEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN*
Vector Type
Other
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now