Rab37

Plasmid
pcDNA5D FRT/TO HA Rab37
Parent Plasmid
pcDNA5D FRT/TO HA
Expressed
HA Rab37
DU Number
DU53107
Genbank
NM_001006638.2 GI:255683301
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGACGGGCACGCCAGGCGCCGTTGCCACCCGGGATGGCGAGGCCCCCGAGCGCTCCCCGCCCTGCAGTCCGAGCTACGACCTCACGGGCAAGGTGATGCTTCTGGGAGACACAGGCGTCGGCAAAACATGTTTCCTGATCCAATTCAAAGACGGGGCCTTCCTGTCCGGAACCTTCATAGCCACCGTCGGCATAGACTTCAGGAACAAGGTGGTGACTGTGGATGGCGTGAGAGTGAAGCTGCAGATCTGGGACACCGCTGGGCAGGAACGGTTCCGAAGCGTCACCCATGCTTATTACAGAGATGCTCAGGCCTTGCTTCTGCTGTATGACATCACCAACAAATCTTCTTTCGACAACATCAGGGCCTGGCTCACTGAGATTCATGAGTATGCCCAGAGGGACGTGGTGATCATGCTGCTAGGCAACAAGGCGGATATGAGCAGCGAAAGAGTGATCCGTTCCGAAGACGGAGAGACCTTGGCCAGGGAGTACGGTGTTCCCTTCCTGGAGACCAGCGCCAAGACTGGCATGAATGTGGAGTTAGCCTTTCTGGCCATCGCCAAGGAACTGAAATACCGGGCCGGGCATCAGGCGGATGAGCCCAGCTTCCAGATCCGAGACTATGTAGAGTCCCAGAAGAAGCGCTCCAGCTGCTGCTCCTTCATGTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGVRVKLQIWDTAG
QERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIA
KELKYRAGHQADEPSFQIRDYVESQKKRSSCCSFM*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now