Rab37

Plasmid
pCMV5D GFP Rab37 T43N
Parent Plasmid
pCMV5D GFP
Expressed
GFP Rab37 T43N
DU Number
DU53119
Genbank
NM_001006638.2 GI:255683301
Tag
GFP
Species
Human
Sequence of Insert
GGATCCATGACGGGCACGCCAGGCGCCGTTGCCACCCGGGATGGCGAGGCCCCCGAGCGCTCCCCGCCCTGCAGTCCGAGCTACGACCTCACGGGCAAGGTGATGCTTCTGGGAGACACAGGCGTCGGCAAAAACTGTTTCCTGATCCAATTCAAAGACGGGGCCTTCCTGTCCGGAACCTTCATAGCCACCGTCGGCATAGACTTCAGGAACAAGGTGGTGACTGTGGATGGCGTGAGAGTGAAGCTGCAGATCTGGGACACCGCTGGGCAGGAACGGTTCCGAAGCGTCACCCATGCTTATTACAGAGATGCTCAGGCCTTGCTTCTGCTGTATGACATCACCAACAAATCTTCTTTCGACAACATCAGGGCCTGGCTCACTGAGATTCATGAGTATGCCCAGAGGGACGTGGTGATCATGCTGCTAGGCAACAAGGCGGATATGAGCAGCGAAAGAGTGATCCGTTCCGAAGACGGAGAGACCTTGGCCAGGGAGTACGGTGTTCCCTTCCTGGAGACCAGCGCCAAGACTGGCATGAATGTGGAGTTAGCCTTTCTGGCCATCGCCAAGGAACTGAAATACCGGGCCGGGCATCAGGCGGATGAGCCCAGCTTCCAGATCCGAGACTATGTAGAGTCCCAGAAGAAGCGCTCCAGCTGCTGCTCCTTCATGTGAGCGGCCGC
Amino Acid Sequence
MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI
FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN
HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGSMTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKNCFLIQFKDGAFLSGT
FIATVGIDFRNKVVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMSSERVIRSEDG
ETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRSSCCSFM*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now