Rab3a

Plasmid
pCMV5D GFP RAb3a
Parent Plasmid
pCMV5D GFP
Expressed
GFP RAb3a
DU Number
DU51540
Genbank
EU831985.1
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGCATCCGCCACAGACTCGCGCTATGGGCAGAAGGAGTCCTCGGATCAGAACTTCGACTACATGTTCAAGATTCTCATCATCGGCAACAGCA
GCGTGGGCAAGACGTCCTTCCTCTTCCGCTATGCTGACGACTCGTTCACGCCTGCCTTCGTCAGCACCGTGGGCATCGACTTCAAGGTCAAGACCATCTA
TCGCAACGACAAGAGGATCAAGCTGCAGATCTGGGACACAGCAGGGCAAGAGCGGTACCGGACCATCACCACCGCATACTACCGGGGCGCTATGGGCTTC
ATCCTCATGTATGACATCACCAACGAGGAATCCTTCAATGCAGTGCAGGACTGGTCCACCCAGATCAAGACCTACTCATGGGACAATGCCCAGGTGCTGC
TGGTAGGAAACAAGTGTGACATGGAGGATGAGCGGGTGGTGTCATCAGAACGTGGCCGGCAGCTAGCTGACCACCTTGGGTTCGAGTTCTTTGAGGCAAG
CGCCAAGGACAACATTAACGTCAAGCAGACCTTTGAGCGCCTGGTGGATGTCATCTGCGAGAAGATGTCCGAGTCGTTGGACACGGCGGACCCTGCGGTC
ACAGGCGCCAAGCAGGGCCCACAGCTCAGTGACCAGCAGGTGCCACCGCACCAGGACTGCGCCTGCTGAGCGGCCGC
Amino Acid Sequence
MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI
FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN
HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGSMASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGID
FKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLG
FEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now