rab30

Plasmid
pCMV5D HA RAB30
Parent Plasmid
pCMV5D HA
Expressed
HA RAB30
DU Number
DU51528
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGAGTATGGAAGATTATGATTTCCTGTTCAAAATTGTTTTAATTGGCAACGCTGGTGTGGGGAAGACGTGCCTCGTCCGAAGATTCACTCAGG GTCTTTTCCCCCCAGGTCAAGGAGCCACAATTGGAGTTGATTTTATGATTAAGACAGTGGAGATTAATGGTGAAAAAGTAAAGCTACAGATCTGGGACAC AGCAGGTCAAGAGAGATTTCGGTCCATTACCCAGAGTTACTACCGAAGCGCCAATGCCTTGATCCTCACCTATGACATTACCTGTGAGGAATCCTTCCGT TGCCTTCCTGAGTGGCTGCGGGAGATAGAACAATATGCCAGCAACAAGGTCATCACTGTGTTAGTGGGCAACAAGATTGACCTGGCTGAAAGGAGAGAGG TTTCCCAGCAGCGAGCTGAAGAATTCTCAGAAGCTCAGGACATGTATTATCTGGAGACCTCAGCCAAGGAATCTGATAATGTGGAGAAACTCTTCCTTGA CTTAGCATGCCGACTCATCAGTGAAGCCAGACAGAACACACTTGTGAACAATGTATCCTCACCCTTACCTGGAGAAGGGAAAAGCATCAGCTATTTGACT TGTTGTAATTTCAACTAAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILT
YDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLP
GEGKSISYLTCCNFN*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now