Rab39a

Plasmid
pCMV5D HA Rab39A
Parent Plasmid
pCMV5D HA
Expressed
HA Rab39A
DU Number
DU51526
Genbank
NM_017516.2
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGAGACCATCTGGATCTACCAGTTCCGCCTCATCGTGATCGGGGACTCCACCGTGGGCAAGTCCTGCCTCCTGCACCGCTTCACCCAGGGCC
GCTTCCCCGGGCTGCGCTCCCCCGCCTGCGACCCCACCGTCGGCGTGGACTTCTTCTCCCGCCTGCTGGAGATCGAGCCGGGCAAGAGGATCAAGCTACA
GCTCTGGGACACGGCGGGACAGGAGCGGTTCAGATCAATAACCCGATCTTATTACCGCAACTCAGTTGGTGGATTTTTAGTATTTGACATTACTAACCGA
CGATCTTTTGAACATGTGAAAGATTGGCTAGAAGAAGCAAAAATGTATGTACAGCCATTTCGGATTGTATTTCTGCTAGTGGGACATAAATGTGATTTAG
CTTCACAACGTCAAGTTACAAGGGAAGAAGCTGAAAAACTGTCAGCAGACTGTGGAATGAAGTATATAGAAACCTCAGCAAAGGATGCTACAAATGTTGA
AGAATCCTTCACAATCTTGACGAGAGACATATATGAACTTATTAAAAAGGGAGAAATTTGTATTCAGGATGGCTGGGAAGGGGTTAAAAGTGGTTTTGTT
CCAAATACTGTGCATTCTTCTGAGGAAGCAGTAAAGCCCAGGAAAGAATGCTTCTGCTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMETIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVG
GFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQD
GWEGVKSGFVPNTVHSSEEAVKPRKECFC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now