RAB3D

Synonyms
D2-2, GOV, RAB16, RAD3D
Plasmid
pCMV5D GFP RAB3D
Parent Plasmid
pCMV5D GFP
Expressed
GFP RAB3D
DU Number
DU26356
Genbank
NM_004283.3
Tag
GFP
Species
Human
Sequence of Insert
GGATCCATGGCATCAGCTGGAGACACCCAGGCAGGCCCACGGGATGCAGCAGATCAGAACTTCGACTATATGTTCAAACTGCTACTGATAGGCAACAGCAGTGTGGGCAAGACTTCCTTCCTGTTCCGATACGCGGACGACTCCTTCACTCCCGCCTTCGTCAGTACTGTGGGCATCGATTTCAAGGTCAAGACCGTCTACCGCCATGACAAGAGGATCAAGCTGCAGATCTGGGACACAGCGGGCCAGGAGCGCTACCGCACCATCACCACGGCCTACTACCGGGGAGCCATGGGCTTCCTGCTCATGTATGACATCGCCAATCAGGAATCCTTTGCCGCTGTGCAGGACTGGGCCACGCAAATCAAGACCTACTCCTGGGACAACGCCCAGGTCATCCTGGTGGGGAACAAGTGTGACCTGGAGGACGAACGTGTTGTGCCTGCTGAGGATGGCCGGAGGCTCGCCGACGACCTTGGTTTCGAGTTCTTTGAAGCCAGTGCCAAGGAGAACATCAATGTGAAGCAGGTCTTCGAGCGCCTGGTGGATGTCATCTGCGAGAAGATGAACGAGTCCCTGGAACCCAGCTCCAGCTCAGGCAGCAACGGGAAAGGCCCGGCCGTGGGGGATGCTCCAGCCCCCCAGCCCAGCAGCTGCAGCTGCTAGGCGGCCGC
Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGSMASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now