Rab31

Synonyms
ras-related protein Rab-31, Rab22b
Plasmid
pSc-B-Rab31
Parent Plasmid
pSC-B
DU Number
DU28220
Genbank
NM_006868.3 → NP_006859.2 Gene ID 11031 Uniprot Q13636
Species
Human
Sequence of Insert
ggatccATGATGGCGATACGGGAGCTCAAAGTGTGCCTTCTCGGGGACACTGGGGTTGGGAAATCAAGCATCGTGTGTCGATTTGTCCAGGATCACTTTGACCACAACATCAGCCCTACTATTGGGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTGAgcggccgc
Amino Acid Sequence
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKW
VKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC*
Vector Type
Other
Antibiotic
Amp; Kan
100042 R 1000 1001 1047 19007
Enquire Now