Rab8A

Plasmid
pcDNA5 FRT/TO GFP RAb8a Q67A S111A
Parent Plasmid
pcDNA5 FRT/TO GFP
Expressed
GFP RAb8a Q67A S111A
DU Number
DU51532
Genbank
NM_005370.4 GI:40548385
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACG
CCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAAATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGC
CGGTGCGGAACGGTTTCGGACGATCACAACGGCCTACTACAGGGGTGCAATGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAAC
ATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCGCTGCAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTT
CCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCT
CGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCCCCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGG
AGCAGCTTTTTCCGATGTGTTCTTCTGTGAGCGGCCGC
Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKR
IKLQIWDTAGAERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHAAADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANI
NVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL*
Vector Type
Mammalian
100042 R 1000 1001 1047 19007
Enquire Now