Rab8 Drosophila

Plasmid
pUAST att Rab8 Drosophila T72A S111A
Parent Plasmid
pUAST att
Expressed
Rab8 Drosophila T72A S111A
DU Number
DU26330
Species
Drosophila Melanogaster
Sequence of Insert
AGATCCATGGCCAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGCGATAGCGGCGTGGGCAAGACCTGCATCCTGTTCCGCTTCAGCGAGGATGCCTTCAACACCACCTTCATCAGCACCATCGGCATCGATTTCAAGATCCGCACCATCGAGCTGGACAACAAGAAGATCAAGCTGCAGATCTGGGATACCGCCGGACAGGAGCGCTTCCGCGCGATTACCACCGCCTACTACCGCGGAGCCATGGGCATCATGCTGGTGTACGATATCACCCAGGAGAAGTCCTTCGAGAACATCAAGAACTGGATTCGCAACATCGAGGAGAACGCCGCCGCCGACGTGGAGAAGATGCTGCTGGGCAACAAGTGCGAGCTGACCGATAAGCGCCAGGTGTCCAAGGAGCGCGGAGAGCAGCTGGCCATCGAGTACGGCATCAAGTTCATGGAGACCAGCGCCAAGGCCAGCATCAACGTGGAGGAGGCCTTTCTGACCCTGGCCAGCGATATCAAGGCCAAGACCGAGAAGCGCATGGAGGCCAACAATCCCCCAAAGGGCGGCCACCAGCTGAAGCCGATGGATAGCCGCACCAAGGATAGCTGGCTGAGCCGCTGCAGCCTGCTGTAGGCGGCCGC
Amino Acid Sequence
MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRAITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENAAADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKDSWLSRCSLL*
Vector Type
Other
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now