Rab1B

Plasmid
pcDNA5FRT/TO FLAG Rab1b S111E
Parent Plasmid
pcDNA5 FRT/TO FLAG
Expressed
Flag-Rab1B S111E
DU Number
DU51413
Genbank
NM_005370.4 GI:40548385
Tag
FLAG
Species
Human
Sequence of Insert
GGATCCATGAACCCCGAATATGACTACCTGTTTAAGCTGCTTTTGATTGGCGACTCAGGCGTGGGCAAGTCATGCCTGCTCCTGCGGTTTGCTGATGACA
CGTACACAGAGAGCTACATCAGCACCATCGGGGTGGACTTCAAGATCCGAACCATCGAGCTGGATGGCAAAACTATCAAACTTCAGATCTGGGACACAGC
GGGCCAGGAACGGTTCCGGACCATCACTTCCAGCTACTACCGGGGGGCTCATGGCATCATCGTGGTGTATGACGTCACTGACCAGGAATCCTACGCCAAC
GTGAAGCAGTGGCTGCAGGAGATTGACCGCTATGCCGAAGAGAACGTCAATAAGCTCCTGGTGGGCAACAAGAGCGACCTCACCACCAAGAAGGTGGTGG
ACAACACCACAGCCAAGGAGTTTGCAGACTCTCTGGGCATCCCCTTCTTGGAGACGAGCGCCAAGAATGCCACCAATGTCGAGCAGGCGTTCATGACCAT
GGCTGCTGAAATCAAAAAGCGGATGGGGCCTGGAGCAGCCTCTGGGGGCGAGCGGCCCAATCTCAAGATCGACAGCACCCCTGTAAAGCCGGCTGGCGGT
GGCTGTTGCTAGGCGGCCGC
Amino Acid Sequence
MDYKDDDDKGSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYD
VTDQESYANVKQWLQEIDRYAEENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKID
STPVKPAGGGCC*
Vector Type
Mammalian
Antibiotic
Amp
Comments
Please shuttle DU25790 to pcDNA5 FRT/TO vector and change with N-ter flag-tag
100042 R 1000 1001 1047 19007
Enquire Now