Rab8B

Plasmid
pCMV5 HA1 Rab8b T22N
Parent Plasmid
pCMV5 HA1
Expressed
HA-Rab8B T22N
DU Number
DU51411
Genbank
Q92930
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACGTACGATTATCTCTTCAAGCTCCTGCTGATCGG
CGACTCGGGGGTAGGCAAGAACTGCCTCCTGTTCCGCTTCTCAGAGGACG
CCTTCAACACCACCTTCATCTCCACCATCGGAATTGATTTTAAAATTAGA
ACGATAGAACTAGATGGAAAGAAAATTAAGCTTCAGATATGGGACACAGC
GGGTCAGGAAAGATTCCGAACAATCACGACAGCGTACTACAGAGGAGCCA
TGGGCATTATGCTGGTCTATGACATCACAAATGAAAAATCCTTTGACAAT
ATTAAAAATTGGATCAGAAACATTGAAGAGCATGCCTCTTCCGATGTCGA
AAGAATGATCCTGGGTAACAAATGTGATATGAATGACAAAAGACAAGTGT
CAAAAGAAAGAGGGGAGAAGCTAGCAATTGACTATGGGATTAAATTCTTG
GAGACAAGCGCAAAATCCAGTGCAAATGTAGAAGAGGCATTTTTTACACT
TGCACGAGATATAATGACAAAACTCAACAGAAAAATGAATGACAGCAATT
CAGCAGGAGCAGGTGGACCAGTGAAAATAACAGAAAACCGATCAAAGAAG
ACCAGTTTCTTTCGTTGCTCGCTACTTTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKNCLLFRFSEDAFNTTFI
STIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVY
DITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEK
LAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGP
VKITENRSKKTSFFRCSLL*
Vector Type
Mammalian
Antibiotic
Amp
Comments
Please shuttle DU43544 with to pCMV HA-1 vector and change to N-ter HA-tag.
100042 R 1000 1001 1047 19007
Enquire Now