Rab10

Plasmid
pET15 6HIS SUMO RAb10 T73S
Parent Plasmid
pET15 6HIS SUMO
Expressed
6His-Sumo-Rab8a T73S
DU Number
DU51405
Tag
6His
SUMO
Species
Human
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHSITTSYYRGAMGIMLVYDITNGKS
FENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWK
SKCC*
Vector Type
Bacterial
Antibiotic
Amp
Comments
Please mutate T73S on DU51062
100042 R 1000 1001 1047 19007
Enquire Now