Rab8a T72S

Plasmid
pET15 6HIS SUMO RAb8a T72S
Parent Plasmid
pET15 6HIS SUMO
Expressed
6His-Sumo-Rab8a T72S
DU Number
DU51400
Tag
SUMO
6His
Species
Human
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRSITTAYYRGAMGIMLVYDITNEKSF
DNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQ
KRSSFFRCVLL*
Vector Type
Bacterial
Antibiotic
Amp
Comments
Please mutate T72S on DU47363
100042 R 1000 1001 1047 19007
Enquire Now