RAB30

Plasmid
pCMV5 HA1 RAb30
Parent Plasmid
pCMV5 HA1
Expressed
HA-RAB30
DU Number
DU51387
Genbank
Q15771
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGAGTATGGAAGATTATGATTTCCTGTTCAAAATTGTTTTAATTGGCAACGCTGGTGTGGGGAAGACGTGCCTCGTCCGAAGATTCACTCAGG GTCTTTTCCCCCCAGGTCAAGGAGCCACAATTGGAGTTGATTTTATGATTAAGACAGTGGAGATTAATGGTGAAAAAGTAAAGCTACAGATCTGGGACAC AGCAGGTCAAGAGAGATTTCGGTCCATTACCCAGAGTTACTACCGAAGCGCCAATGCCTTGATCCTCACCTATGACATTACCTGTGAGGAATCCTTCCGT TGCCTTCCTGAGTGGCTGCGGGAGATAGAACAATATGCCAGCAACAAGGTCATCACTGTGTTAGTGGGCAACAAGATTGACCTGGCTGAAAGGAGAGAGG TTTCCCAGCAGCGAGCTGAAGAATTCTCAGAAGCTCAGGACATGTATTATCTGGAGACCTCAGCCAAGGAATCTGATAATGTGGAGAAACTCTTCCTTGA CTTAGCATGCCGACTCATCAGTGAAGCCAGACAGAACACACTTGTGAACAATGTATCCTCACCCTTACCTGGAGAAGGGAAAAGCATCAGCTATTTGACT TGTTGTAATTTCAACTAAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILT
YDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLP
GEGKSISYLTCCNFN*
Vector Type
Mammalian
Antibiotic
Amp
Comments
in pCMV5
100042 R 1000 1001 1047 19007
Enquire Now