Rab32

Plasmid
pSCB RAB32 Bam Xho
Parent Plasmid
pSC-B
DU Number
DU52588
Genbank
NM_006834.3
Species
Human
Sequence of Insert
GGATCCATGGCGGGCGGAGGAGCCGGGGACCCCGGCCTGGGGGCGGCCGCCGCCCCAGCGCCCGAGACCCGCGAGCACCTCTTCAAGGTGCTGGTGATCGGCGAGCTTGGCGTGGGCAAGACCAGCATCATCAAGCGCTACGTCCACCAGCTCTTCTCCCAGCACTACCGGGCCACCATCGGGGTGGACTTCGCCCTCAAGGTCCTCAACTGGGACAGCAGGACTCTGGTGCGCCTGCAGCTGTGGGACATCGCGGGGCAGGAGCGATTTGGCAACATGACCCGAGTATACTACAAGGAAGCTGTTGGTGCTTTTGTAGTCTTTGATATATCAAGAAGTTCCACATTTGAGGCAGTCTTAAAATGGAAAAGTGATCTGGATAGTAAAGTTCATCTTCCAAATGGCAGCCCTATCCCTGCTGTCCTCTTGGCTAACAAATGTGACCAGAACAAGGACAGTAGCCAGAGTCCTTCCCAGGTGGACCAATTCTGCAAAGAACATGGCTTTGCCGGATGGTTTGAAACCTCTGCAAAGGATAACATAAACATAGAGGAAGCTGCCCGGTTCCTAGTGGAGAAGATTCTTGTAAACCACCAAAGCTTTCCTAATGAAGAAAACGATGTGGACAAAATTAAGCTAGATCAAGAGACCTTGAGAGCAGAGAACAAATCCCAGTGTTGCTGACGGCCGCGTAAGGGCGAATTCCACAGTGGATATCAAGCTTATCGATACCGTCGAC

Amino Acid Sequence
MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAV
GAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFP
NEENDVDKIKLDQETLRAENKSQCC*
Vector Type
Other
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now