RAB8A

Synonyms
MEL, RAB8
Plasmid
pcDNA5D frtTO HA RAB8A T72E
Parent Plasmid
pcDNA5D frtTO HA
Expressed
HA-RAB8A T72E
DU Number
DU52576
Genbank
NM_005370.4
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACGCCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAAATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGCCGGTCAGGAACGGTTTCGGGAGATCACAACGGCCTACTACAGGGGTGCAATGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAACATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCTCTGCAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTTCCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCTCGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCCCCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGGAGCAGCTTTTTCCGATGTGTTCTTCTGTGAGCGGCCGC

Amino Acid Sequence
MYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFREITTAYYRGAMGIMLVY
DITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQG
VKITPDQQKRSSFFRCVLL*
Vector Type
Mammalian
Antibiotic
Amp
Comments
T72E
100042 R 1000 1001 1047 19007
Enquire Now