Rab8A

Plasmid
pNHD1.3 6HIS Rab8a + Gro EL/ES
Parent Plasmid
pNHD1.3 + Gro EL/ES
Expressed
6His Rab8A + GRO EL/ES
DU Number
DU51338
Genbank
P61006
Tag
6His
Species
Human
Sequence of Insert
TCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATGTACATATGGGTCATCATCACCATCACCATATGGCGAAGACCTACGATTACCTGTTCAAGCTGC
TGCTGATCGGGGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACGCCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTT
TAAAATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGCCGGTCAGGAACGGTTTCGGACGATCACAACGGCCTACTAC
AGGGGTGCAATGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAACATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCTCTG
CAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTTCCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAAT
CAAGTTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCTCGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAA
GGCAACAGCCCCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGGAGCAGCTTTTTCCGATGTGTTCTTCTGTGAGGGGTACC
Amino Acid Sequence
MGHHHHHHMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITN
EKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKIT
PDQQKRSSFFRCVLL*
Vector Type
Bacterial
Antibiotic
Tetracycline
Comments
subclone 6-His-Rab8a from plasmid DU51049 and insert into pNHD2 vector (using identical MCS as has been done for Rabs by Chin lab) and in addition subclone GroEL and GroES from plasmid DU51048 and insert into pNHD2 vector (in the same region as has been done by Chin lab). I have emailed you separately with info on Chin construct so that you know sites of insertion into pNHD2
100042 R 1000 1001 1047 19007
Enquire Now