RAb3IP alpha 153-237

Plasmid
pET6HIS SUMO RAb3IP alpha 153-237
Parent Plasmid
pET15b 6His SUMO
Expressed
6HIS SUMO RAb3IP alpha 153-237
DU Number
DU51274
Genbank
NP_071901
Tag
SUMO
6His
Species
Human
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVA*
Vector Type
Bacterial
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now