RAB12

Plasmid
pET15b SUMOb RAB12 T56N
Parent Plasmid
pET15b 6His SUMO
Expressed
6HIS-SUMOb-RAB12 T56N
DU Number
DU52257
Genbank
NM_001025300.2
Tag
6His
SUMO
Species
Human
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGMDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKNSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIW
DTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEI
FLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC*
Vector Type
Bacterial
Antibiotic
Amp
Comments
T56N and silent T>C base change at position 6. SUMO blunt mutated via serine deletion in BamHI site.
100042 R 1000 1001 1047 19007
Enquire Now