Rab3IP Alpha 1 isoform

Plasmid
pET15b 6HIS SUMO Rab3IP alpha 1 isoform
Parent Plasmid
pET15b 6His SUMO
Expressed
6His Sumo Rab3IP alpha 1 isoform
DU Number
DU51172
Genbank
NP_071901
Tag
6His
SUMO
Species
Human
Sequence of Insert
ATGGCTAATGATCCCTTGGAAGGCTTCCATGAAGTAAACCTTGCTTCACCTACTTCTCCGGACCTTCTTGGTGTGTATGAATCAGGAACTCAAGAGCAGA
CTACCTCACCAAGTGTCATCTACCGGCCACACCCTTCAGCTTTATCCTCTGTACCTATCCAGGCAAATGCATTAGATGTTTCTGAACTTCCTACACAACC
CGTGTATTCATCCCCCAGACGTTTAAATTGTGCGGAAATATCTAGTATCAGCTTTCATGTTACAGACCCAGCCCCTTGCTCTACCTCTGGAGTCACAGCT
GGATTAACTAAATTAACTACAAGAAAGGACAACTATAATGCAGAGAGAGAGTTTTTACAGGGTGCTACTATAACAGAGGCTTGCGATGGCAGTGATGATA
TTTTTGGGTTGAGTACTGATAGTCTGTCTCGTTTACGAAGCCCATCTGTTTTGGAAGTTAGAGAAAAGGGCTATGAACGATTAAAAGAAGAACTCGCAAA
AGCTCAGAGGGAACTGAAGTTAAAAGATGAAGAATGTGAGAGGCTTTCAAAAGTGCGAGATCAACTTGGACAGGAATTGGAAGAACTCACAGCTAGTCTA
TTTGAGGAAGCTCATAAAATGGTGAGAGAAGCAAATATCAAGCAGGCAACAGCAGAAAAACAGCTAAAAGAAGCACAAGGAAAAATTGATGTACTTCAAG
CTGAAGTAGCTGCATTGAAGACACTTGTATTGTCCAGTTCTCCAACATCACCTACGCAGGAGCCTTTGCCAGGTGGAAAGACACCTTTTAAAAAGGGGCA
TACAAGAAATAAAAGCACAAGCAGTGCTATGAGTGGCAGTCATCAGGACCTCAGTGTGATACAGCCAATTGTAAAAGACTGCAAAGAGGCTGACTTATCC
TTGTATAATGAATTCCGATTGTGGAAGGATGAGCCCACAATGGACAGGACGTGTCCTTTCTTAGACAAAATCTACCAGGAAGATATCTTTCCATGTTTAA
CATTCTCAAAAAGTGAGTTGGCTTCAGCTGTTCTGGAGGCTGTGGAAAACAATACTCTAAGCATTGAACCAGTGGGATTACAACCTATCCGGTTTGTGAA
AGCTTCTGCAGTTGAATGCGGAGGACCAAAAAAATGTGCTCTCACTGGCCAGAGTAAGTCCTGTAAACACAGAATTAAATTAGGGGACTCAAGCAACTAT
TATTATATTTCTCCTTTTTGCAGATACAGGATCACTTCTGTATGTAACTTTTTTACATACATTCGATACATTCAGCAGGGACTCGTGAAACAGCAGGATG
TTGATCAGATGTTTTGGGAGGTTATGCAGTTGAGAAAAGAGATGTCATTGGCAAAGCTGGGTTATTTCAAAGAGGAACTCTGAGCGGCCGC
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTS
GVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEEL
TASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKE
ADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGD
SSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL*
Vector Type
Bacterial
Antibiotic
Amp
Comments
This is isoform 2 minus the first 16 amino acids (DU26117)
100042 R 1000 1001 1047 19007
Enquire Now