RAB39B

Plasmid
pET6HIS SUMO Rab39B S73T
Parent Plasmid
pET15b 6His SUMO1
Expressed
6HIS SUMO Rab39B S73T
DU Number
DU51130
Genbank
Q96DA2
Tag
6His
SUMO
Species
Human
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGMEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRTITRAYYRNSVGGLLLFDITNRRS
FQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPN
VVHSSEEVVKSERRCLC*
Vector Type
Bacterial
Antibiotic
Amp
Comments
in pET vector
100042 R 1000 1001 1047 19007
Enquire Now