rab12

Plasmid
pBabeD Puro HA Rab12 S106E
Parent Plasmid
pBabeD puro HA
Expressed
HA rab12 S106E
DU Number
DU51110
Genbank
NM_001025300.2
Tag
HA
Species
Human
Sequence of Insert
GAATTCATGGATCCGGGCGCCGCGCTGCAGAGGCGGGCCGGGGGCGGCGGCGGTCTGGGCGCGGGCTCCCCGGCGCTGTCGGGCGGCCAGGGCCGCCGGAGGAAGCAGCCCCCCAGGCCGGCCGACTTCAAGTTGCAGGTCATCATTATCGGCTCCCGCGGCGTGGGCAAGACCAGCCTGATGGAGCGCTTCACCGACGACACCTTCTGCGAGGCCTGCAAGTCCACCGTGGGTGTTGACTTCAAAATCAAAACTGTAGAGCTAAGAGGAAAGAAAATTAGATTACAGATCTGGGACACAGCAGGTCAGGAGAGATTCAACGAGATTACCTCAGCTTATTACAGAAGTGCCAAGGGGATCATATTAGTATATGATATCACTAAGAAGGAGACATTTGATGATTTGCCGAAATGGATGAAGATGATTGATAAGTATGCTTCAGAAGATGCAGAGCTTCTCTTAGTTGGAAATAAGTTGGACTGTGAAACGGACAGAGAAATCACCAGGCAGCAGGGGGAAAAGTTTGCACAGCAGATCACTGGGATGCGGTTCTGTGAAGCAAGTGCCAAGGATAACTTCAATGTGGACGAGATATTTTTGAAACTTGTCGATGACATTCTGAAAAAGATGCCTCTGGATATTTTAAGGAATGAGTTGTCCAATAGTATCCTGTCGTTACAACCAGAGCCTGAGATACCGCCAGAACTGCCTCCACCAAGACCACATGTCCGATGCTGTTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSEFMDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPP
RPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVEL
RGKKIRLQIWDTAGQERFNEITSAYYRSAKGIILVYDITKKETFDDLPKW
MKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEAS
AKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPP
PRPHVRCC*
Vector Type
Mammalian
Antibiotic
Amp
Comments
in pBABE
100042 R 1000 1001 1047 19007
Enquire Now