rab12

Plasmid
pBABE puro GFP RAb12
Parent Plasmid
pBabeD puro GFP
Expressed
GFP rab12
DU Number
DU51090
Genbank
NM_001025300.2
Tag
GFP
Species
Human
Sequence of Insert
GAATTCATGGATCCGGGCGCCGCGCTGCAGAGGCGGGCCGGGGGCGGCGGCGGTCTGGGCGCGGGCTCCCCGGCGCTGTCGGGCGGCCAGGGCCGCCGGAGGAAGCAGCCCCCCAGGCCGGCCGACTTCAAGTTGCAGGTCATCATTATCGGCTCCCGCGGCGTGGGCAAGACCAGCCTGATGGAGCGCTTCACCGACGACACCTTCTGCGAGGCCTGCAAGTCCACCGTGGGTGTTGACTTCAAAATCAAAACTGTAGAGCTAAGAGGAAAGAAAATTAGATTACAGATCTGGGACACAGCAGGTCAGGAGAGATTCAACAGCATTACCTCAGCTTATTACAGAAGTGCCAAGGGGATCATATTAGTATATGATATCACTAAGAAGGAGACATTTGATGATTTGCCGAAATGGATGAAGATGATTGATAAGTATGCTTCAGAAGATGCAGAGCTTCTCTTAGTTGGAAATAAGTTGGACTGTGAAACGGACAGAGAAATCACCAGGCAGCAGGGGGAAAAGTTTGCACAGCAGATCACTGGGATGCGGTTCTGTGAAGCAAGTGCCAAGGATAACTTCAATGTGGACGAGATATTTTTGAAACTTGTCGATGACATTCTGAAAAAGATGCCTCTGGATATTTTAAGGAATGAGTTGTCCAATAGTATCCTGTCGTTACAACCAGAGCCTGAGATACCGCCAGAACTGCCTCCACCAAGACCACATGTCCGATGCTGTTGAGCGGCCGC
Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSSEFMDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGV
GKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLV
GNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC*
Vector Type
Mammalian
Antibiotic
Amp
Comments
in pBABE
100042 R 1000 1001 1047 19007
Enquire Now